Prgx

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Prgx
  Conformer 1
(PDB) 		2axu (G)
  Conformer 2
(PDB) 		2axu (K)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 33 0.58   72 - 76   80 - 101   119 - 124
2 59 0.33   6 - 65
3 191 0.45   77 - 79   104 - 118   128 - 302

Sequence


           _____________________________________________________________65______76_79___________________101_____________117____124_ 
 2axu(G) : FKIGSVLKQIRQELNYHQIDLYSGIsKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGnsVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNI 
         :                                                                                                                          
 2axu(K) : **IGSVLKQIRQELNYHQIDLYSGIsKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGnsVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNI 
           _____________________________________________________________65______76_79___________________101_____________117____124_ 

           ________________________________________________________________________________________________________________________ 
 2axu(G) : EVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPyPIVDSFGKDYDLTIQTVLKNALTISInRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLT 
         :                                                                                                                          
 2axu(K) : EVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPyPIVDSFGKDYDLTIQTVLKNALTISInRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLT 
           ________________________________________________________________________________________________________________________ 

           ___________________________________________________________                                                              
 2axu(G) : DKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIE                                                              
         :                                                                                                                          
 2axu(K) : DKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVA**                                                              
           ___________________________________________________________                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.5
Translation
(A) 		1.2
Closure
(%) 		87.2
Bending Residues
( green ) 		  65 - 72
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		7.0
Translation
(A) 		0.1
Closure
(%) 		51.7
Bending Residues
( green ) 		  76 - 77
  79 - 80
  101 - 104
  117 - 119
  124 - 132
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download