Transcriptional Regulator

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Regulator
  Conformer 1
(PDB) 		2dh0 (B)
  Conformer 2
(PDB) 		1v7b (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 101 0.6   9 - 78   114 - 142   169 - 170
2 30 1.04   84 - 113
3 26 0.8   143 - 168

Sequence


           __________________________________________________________________________76__________________________________113_______ 
 2dh0(B) : MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQW 
         :                                                                                                                          
 1v7b(A) : MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQW 
           __________________________________________________________________________76__________________________________113_______ 

           ___________________142_______________________168_____________                                                            
 2dh0(B) : IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPSELHHHH                                                            
         :                                                                                                                          
 1v7b(A) : IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS******                                                            
           ___________________142_______________________168_____________                                                            

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.2
Translation
(A) 		-0.4
Closure
(%) 		93.3
Bending Residues
( green ) 		  76 - 85
  113 - 114
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		8.0
Translation
(A) 		0.9
Closure
(%) 		84.8
Bending Residues
( green ) 		  142 - 143
  168 - 170
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download