Beta-Phosphoglucomutase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-Phosphoglucomutase
  Conformer 1
(PDB) 		2wf5 (A)
  Conformer 2
(PDB) 		6h8x (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 30 0.35   13 - 15   83 - 97   120 - 131
2 111 0.43   3 - 12   98 - 113   132 - 216
3 67 0.62   16 - 82

Sequence


           __________12____________________________________________________________________82_____________97_____________113_______ 
 2wf5(A) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
         :                                                                                                                          
 6h8x(B) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
           __________12____________________________________________________________________82_____________97_____________113_______ 

           ________131________________________________________________________________________________________                      
 2wf5(A) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ*                      
         :                                                                                                                          
 6h8x(B) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK                      
           ________131________________________________________________________________________________________                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.2
Translation
(A) 		0.3
Closure
(%) 		21.4
Bending Residues
( green ) 		  12 - 15
  97 - 98
  113 - 120
  131 - 132
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		16.3
Translation
(A) 		0.5
Closure
(%) 		86.8
Bending Residues
( green ) 		  13 - 16
  82 - 83
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download