Intron-Encoded Endonuclease I-Ppoi

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Intron-Encoded Endonuclease I-Ppoi
  Conformer 1
(PDB) 		1a74 (A)
  Conformer 2
(PDB) 		1evx (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 125 0.63   12 - 115   124 - 144
2 25 0.38   116 - 123   145 - 161

Sequence


           _______________________________________________________________________________________________________________115_____1 
 1a74(A) : ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYGVGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCHNTRCHNPLHLCWESLDDNKG 
         :                                                                                                                          
 1evx(A) : ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYGVGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCHNTRCHNPLHLCWESLDDNKG 
           _______________________________________________________________________________________________________________115_____1 

           23__________________144___________________                                                                               
 1a74(A) : RNWCPGPNGGCVHAVVCLRQGPLYGPGATVAGPQQRGSHFVV                                                                               
         :                                                                                                                          
 1evx(A) : RNWCPGPNGGCVHAVVCLRQGPLYGPGATVAGPQQRGSHFVV                                                                               
           23__________________144___________________                                                                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.1
Translation
(A) 		0.2
Closure
(%) 		90.0
Bending Residues
( green ) 		  115 - 116
  123 - 124
  144 - 145
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download