Jumonji Domain-Containing Protein 2A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Jumonji Domain-Containing Protein 2A
  Conformer 1
(PDB) 		2gf7 (C)
  Conformer 2
(PDB) 		2gfa (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 54 0.72   899 - 926   980 - 1005
2 47 0.92   927 - 979

Sequence


           _______________________921_______________________________________________________979________________________________     
 2gf7(C) : *QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP     
         :                                                                                                                          
 2gfa(B) : LQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVS------gPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP     
           _______________________921_______________________________________________________979________________________________     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		21.0
Translation
(A) 		0.5
Closure
(%) 		42.7
Bending Residues
( green ) 		  921 - 927
  979 - 980
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download