Protein Tonb

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Protein Tonb
  Conformer 1
(PDB) 		2gsk (B)
  Conformer 2
(PDB) 		1ihr (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 34 6.36   167 - 169   201 - 231
2 31 2.23   170 - 200

Sequence


           ____________167______________________________200_____________________________________                                    
 2gsk(B) : PRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKIN****                                    
         :                                                                                                                          
 1ihr(A) : ************ARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTE                                    
           ____________167______________________________200_____________________________________                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		175.8
Translation
(A) 		1.5
Closure
(%) 		33.8
Bending Residues
( green ) 		  167 - 170
  200 - 201
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download