Protein Hi0146

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Protein Hi0146
  Conformer 1
(PDB) 		2cex (A)
  Conformer 2
(PDB) 		3b50 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 167 0.47   4 - 80   88 - 125   212 - 253   294 - 303
2 23 0.37   81 - 87   126 - 126   210 - 211   281 - 293
3 108 0.65   127 - 209   256 - 280

Sequence


           ______________________________________________________________________________80_____87_________________________________ 
 2cex(A) : *DYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLS 
         :                                                                                                                          
 3b50(A) : ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLS 
           ______________________________________________________________________________80_____87_________________________________ 

           __125__________________________________________________________________________________210______________________________ 
 2cex(A) : QAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAEN 
         :                                                                                                                          
 3b50(A) : QAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAEN 
           __125__________________________________________________________________________________210______________________________ 

           _______250___________________________280__________293_________________                                                   
 2cex(A) : AAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAIN*****                                                   
         :                                                                                                                          
 3b50(A) : AAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPKGEA                                                   
           _______250___________________________280__________293_________________                                                   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 13.5 0.3 73.5   80 - 81   87 - 88   125 - 126   210 - 213   293 - 296 Bending Region Analysis
1 3 32.8 -0.1 99.6   125 - 127   250 - 256 Bending Region Analysis
3 2 19.8 0.0 36.6   126 - 127   209 - 211   280 - 281 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download