Transcriptional Regulator (Ntrc Family)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Regulator (Ntrc Family)
  Conformer 1
(PDB) 		1ny6 (A)
  Conformer 2
(PDB) 		1ny6 (N)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 217 0.78   140 - 207   228 - 260   267 - 382
2 26 0.96   208 - 227   261 - 266

Sequence


           ___________________________________________________________________207_________________227______________________________ 
 1ny6(A) : EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIES 
         :                                                                                                                          
 1ny6(N) : EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIES 
           ___________________________________________________________________207_________________227______________________________ 

           260___266_______________________________________________________________________________________________________________ 
 1ny6(A) : GKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDR 
         :                                                                                                                          
 1ny6(N) : GKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDR 
           260___266_______________________________________________________________________________________________________________ 

           _______                                                                                                                  
 1ny6(A) : GELSCLV                                                                                                                  
         :                                                                                                                          
 1ny6(N) : GELSCLV                                                                                                                  
           _______                                                                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.2
Translation
(A) 		0.1
Closure
(%) 		53.9
Bending Residues
( green ) 		  207 - 208
  227 - 228
  260 - 261
  266 - 267
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download