Transcriptional Regulator

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Regulator
  Conformer 1
(PDB) 		2zoz (A)
  Conformer 2
(PDB) 		2zoy (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 71 0.39   44 - 69   83 - 119   139 - 144   171 - 172
2 39 0.29   5 - 43
3 27 0.58   75 - 82   120 - 138
4 26 0.49   145 - 170

Sequence


           _________________________________________43________________________69___________82__________________________________119_ 
 2zoz(A) : **TSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQW 
         :                                                                                                                          
 2zoy(A) : MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQW 
           _________________________________________43________________________69___________82__________________________________119_ 

           _______________138___144_______________________170_____                                                                  
 2zoz(A) : IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP*                                                                  
         :                                                                                                                          
 2zoy(A) : IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS                                                                  
           _______________138___144_______________________170_____                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.0
Translation
(A) 		-0.2
Closure
(%) 		31.4
Bending Residues
( green ) 		  43 - 44
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		7.2
Translation
(A) 		-0.1
Closure
(%) 		64.6
Bending Residues
( green ) 		  69 - 75
  82 - 84
  119 - 120
  138 - 139
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( violet ) 		4
Rotation Angle
(deg) 		7.9
Translation
(A) 		0.2
Closure
(%) 		62.8
Bending Residues
( green ) 		  144 - 145
  170 - 171
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download