Zinc-Alpha-2-Glycoprotein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Zinc-Alpha-2-Glycoprotein
  Conformer 1
(PDB) 		2icn (A)
  Conformer 2
(PDB) 		1t7w (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 171 0.63   7 - 174   179 - 181
2 98 0.64   175 - 178   182 - 275

Sequence


           ________________________________________________________________________________________________________________________ 
 2icn(A) : ENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYDG 
         :                                                                                                                          
 1t7w(A) : ***DGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYKDSTGSHVLQGRFGCEIENNRSSGAFWKYYYDG 
           ________________________________________________________________________________________________________________________ 

           __________________________________________________174___________________________________________________________________ 
 2icn(A) : KDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGT 
         :                                                                                                                          
 1t7w(A) : KDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGT 
           __________________________________________________174___________________________________________________________________ 

           ____________________________________                                                                                     
 2icn(A) : YQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEA                                                                                     
         :                                                                                                                          
 1t7w(A) : YQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEA                                                                                     
           ____________________________________                                                                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		14.7
Translation
(A) 		-0.5
Closure
(%) 		95.1
Bending Residues
( green ) 		  174 - 182
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download