Molybdenum-Binding-Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Molybdenum-Binding-Protein
  Conformer 1
(PDB) 		1h9k (A)
  Conformer 2
(PDB) 		1h9m (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 77 0.38   3 - 7   60 - 131
2 60 0.54   8 - 59   132 - 139

Sequence


           _________7__________________________________________________59__________________________________________________________ 
 1h9k(A) : GSHMKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVA 
         :                                                                                                                          
 1h9m(A) : ***MKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVA 
           _________7__________________________________________________59__________________________________________________________ 

           ___________131__________                                                                                                 
 1h9k(A) : ELGLKPGASASAVIKASNVILGVP                                                                                                 
         :                                                                                                                          
 1h9m(A) : ELGLKPGASASAVIKASNVILGVP                                                                                                 
           ___________131__________                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.5
Translation
(A) 		-0.4
Closure
(%) 		23.3
Bending Residues
( green ) 		  7 - 8
  59 - 60
  131 - 132
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download