Mothers Against Decapentaplegic Homolog 3

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mothers Against Decapentaplegic Homolog 3
  Conformer 1
(PDB) 		1u7f (A)
  Conformer 2
(PDB) 		1mjs (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 133 0.67   232 - 343   371 - 401   404 - 405
2 38 0.81   344 - 370   402 - 403   406 - 414

Sequence


           ________________________________________________________________________________________________________________342_____ 
 1u7f(A) : EPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQE 
         :                                                                                                                          
 1mjs(A) : *PAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQR-----aTVCKIPPGCNLKIFNNQE 
           ________________________________________________________________________________________________________________341_____ 

           ____________________370____________________________401______________________                                             
 1u7f(A) : FAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSv                                             
         :                                                                                                                          
 1mjs(A) : FAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGW-------tVTSTPCWIELHLNGPLQWLDKVLTQMGSPS*****                                             
           ____________________369____________________________400______________________                                             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.5
Translation
(A) 		0.9
Closure
(%) 		78.1
Bending Residues
( green ) 		  342 - 344
  370 - 371
  401 - 406
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download