Phenylalanine-4-Hydroxylase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Phenylalanine-4-Hydroxylase
  Conformer 1
(PDB) 		1j8u (A)
  Conformer 2
(PDB) 		1kw0 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 197 1.98   121 - 194   220 - 315   391 - 392   398 - 422
2 105 0.86   195 - 219   316 - 390   393 - 397

Sequence


           __________________________________________________________________________194______________________219__________________ 
 1j8u(A) : VPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTC 
         :                                                                                                                          
 1kw0(A) : VPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTC 
           __________________________________________________________________________194______________________219__________________ 

           ___________________________________________________________________________315__________________________________________ 
 1j8u(A) : TGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYC 
         :                                                                                                                          
 1kw0(A) : TGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYC 
           ___________________________________________________________________________315__________________________________________ 

           ______________________________390__________________________________                                                      
 1j8u(A) : LSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVL                                                      
         :                                                                                                                          
 1kw0(A) : LSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVL                                                      
           ______________________________390__________________________________                                                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.4
Translation
(A) 		0.5
Closure
(%) 		99.5
Bending Residues
( green ) 		  194 - 195
  219 - 220
  315 - 316
  390 - 398
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download