Titin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Titin
  Conformer 1
(PDB) 		2rjm (A)
  Conformer 2
(PDB) 		2rik (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 100 0.17   12 - 13   91 - 188
2 86 0.15   3 - 11   14 - 90
3 87 0.13   189 - 275

Sequence


           ____________11___________________________________________________________________________88_____________________________ 
 2rjm(A) : AMAPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVTKGDAGQYTCYASNVAGKDSCSAQLGVQAPPRFIKKLEPSRIVKQDEHTRYEC 
         :                                                                                                                          
 2rik(A) : AMAPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVTKGDAGQYTCYASNVAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEHTRYEC 
           ____________11___________________________________________________________________________88_____________________________ 

           __________________________________________________________________186___________________________________________________ 
 2rjm(A) : KIGGSPEIKVLWYKDETEIQESSKFRMSFVESVAVLEMYNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPVFRKKPHPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKI 
         :                                                                                                                          
 2rik(A) : KIGGSPEIKVLWYKDETEIQESSKFRMSFVESVAVLEMYNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPVFRKKPHPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKI 
           __________________________________________________________________186___________________________________________________ 

           ___________________________________________                                                                              
 2rjm(A) : MSENFLTSIHILNVDSADIGEYQCKASNDVGSYTCVGSITLKA                                                                              
         :                                                                                                                          
 2rik(A) : MSENFLTSIHILNVDSADIGEYQCKASNDVGSYTCVGSITLKA                                                                              
           ___________________________________________                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		1.3
Translation
(A) 		0.2
Closure
(%) 		52.9
Bending Residues
( green ) 		  11 - 14
  88 - 91
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		1.4
Translation
(A) 		0.2
Closure
(%) 		82.0
Bending Residues
( green ) 		  186 - 189
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download