Translin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Translin
  Conformer 1
(PDB) 		1j1j (A)
  Conformer 2
(PDB) 		4jhf (H)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 148 0.5   4 - 144   186 - 198
2 56 0.3   145 - 185   199 - 213

Sequence


           ________________________________________________________________________________________________________________________ 
 1j1j(A) : MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVT 
         :                                                                                                                          
 4jhf(H) : MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVH------dIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVT 
           ________________________________________________________________________________________________________________________ 

           _____________________144______________________________________185__________198___________________                        
 1j1j(A) : EILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGF                        
         :                                                                                                                          
 4jhf(H) : EILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRG*                        
           _____________________144______________________________________185__________198___________________                        

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.1
Translation
(A) 		-0.1
Closure
(%) 		24.2
Bending Residues
( green ) 		  144 - 145
  185 - 189
  198 - 199
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download