Tryptophan 2,3-Dioxygenase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tryptophan 2,3-Dioxygenase
  Conformer 1
(PDB) 		5tia (B)
  Conformer 2
(PDB) 		6pyz (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 302 0.24   41 - 237   266 - 379
2 28 0.38   238 - 265

Sequence


           ________________________________________________________________________________________________________________________ 
 5tia(B) : *GLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQ 
         :                                                                                                                          
 6pyz(B) : GGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQ 
           ________________________________________________________________________________________________________________________ 

           _________________________________________________________________________237_________________________265________________ 
 5tia(B) : FRLLENKIGVLQN-----yRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGE 
         :                                                                                                                          
 6pyz(B) : FRLLENKIGVLQNMRVPYyRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGE 
           _________________________________________________________________________237_________________________265________________ 

           ____________________________________________________________________________________________________________             
 5tia(B) : RRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKM********             
         :                                                                                                                          
 6pyz(B) : RRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFL             
           ____________________________________________________________________________________________________________             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.2
Translation
(A) 		-0.1
Closure
(%) 		5.2
Bending Residues
( green ) 		  237 - 238
  265 - 266
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download