Tyrosine-Protein Kinase Btk

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tyrosine-Protein Kinase Btk
  Conformer 1
(PDB) 		3gen (A)
  Conformer 2
(PDB) 		3k54 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 167 0.34   452 - 456   475 - 538   559 - 656
2 52 0.99   397 - 430   457 - 474   539 - 541

Sequence


           ____________________________________430_________________________________________474_____________________________________ 
 3gen(A) : YGSWEIDPKDLTFLKELG---fGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEY 
         :                                                                                                                          
 3k54(A) : YGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKE-------fIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEY 
           ____________________________________430_________________________________________474_____________________________________ 

           ________________________538_____________________________________________________________________________________________ 
 3gen(A) : LESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMY 
         :                                                                                                                          
 3k54(A) : LESKQFLHRDLAARNCLVNDQGVVKVSDFG-----------------fPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMY 
           ________________________538_____________________________________________________________________________________________ 

           ___________________________                                                                                              
 3gen(A) : SCWHEKADERPTFKILLSNILDVMDEE                                                                                              
         :                                                                                                                          
 3k54(A) : SCWHEKADERPTFKILLSNILDVMDEE                                                                                              
           ___________________________                                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.3
Translation
(A) 		0.6
Closure
(%) 		94.9
Bending Residues
( green ) 		  430 - 457
  474 - 478
  538 - 561
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download