Glutamate Receptor 3

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor 3
  Conformer 1
(PDB) 		3dln (A)
  Conformer 2
(PDB) 		4f1y (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 149 0.39   6 - 109   195 - 196   217 - 259
2 105 0.43   110 - 194   197 - 216

Sequence


           _______________________________________________________________________________________________________109______________ 
 3dln(A) : RTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 4f1y(A) : RTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           _______________________________________________________________________________________________________109______________ 

           ___________________________________________________________________193____________________216___________________________ 
 3dln(A) : AEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGTPVNLAVLKLSE 
         :                                                                                                                          
 4f1y(A) : AEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNLAVLKLNE 
           ___________________________________________________________________193____________________216___________________________ 

           __________________                                                                                                       
 3dln(A) : QGILDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 4f1y(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
           __________________                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.0
Translation
(A) 		-0.3
Closure
(%) 		96.2
Bending Residues
( green ) 		  109 - 110
  193 - 197
  216 - 220
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download