Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		2xxt (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 141 0.74   10 - 110   169 - 173   212 - 246
2 96 0.44   111 - 168   174 - 211

Sequence


           _______________________________________________________________________________________________________109______________ 
 2f36(A) : TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
         :                                                                                                                          
 2xxt(A) : SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
           _______________________________________________________________________________________________________537______________ 

           __________________________________________168__173___________________________________211________________________________ 
 2f36(A) : DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKL 
         :                                                                                                                          
 2xxt(A) : DDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKL 
           __________________________________________716__721___________________________________759________________________________ 

           _______________                                                                                                          
 2f36(A) : HMMKEKWWRGNGCPS                                                                                                          
         :                                                                                                                          
 2xxt(A) : HMMKEKWW*******                                                                                                          
           _______________                                                                                                          

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.9
Translation
(A) 		0.0
Closure
(%) 		100.0
Bending Residues
( green ) 		  109 - 111
  168 - 169
  173 - 174
  211 - 214
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download