Guanylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Guanylate Kinase
  Conformer 1
(PDB) 		1s96 (B)
  Conformer 2
(PDB) 		2an9 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 144 0.63   5 - 34   87 - 204
2 51 0.71   35 - 86

Sequence


           _______________________________34_________________________________________________85____________________________________ 
 1s96(B) : *QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKE-iSRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQK-pHARSI 
         :                                                                                                                          
 2an9(A) : AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSI 
           _______________________________34_________________________________________________85____________________________________ 

           _____________________________________________________________________________________                                    
 1s96(B) : FILPPSKIELDRRLRGRGQDSEEVIAKR-aQAVAE-sHYAEYDYLIVNDDFDTALTDLKTIIRAERLR-sRQKQRHDALISKLLA                                    
         :                                                                                                                          
 2an9(A) : FILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA                                    
           _____________________________________________________________________________________                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		28.7
Translation
(A) 		0.2
Closure
(%) 		78.6
Bending Residues
( green ) 		  34 - 35
  85 - 90
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download