Sln1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Sln1
  Conformer 1
(PDB) 		1oxb (B)
  Conformer 2
(PDB) 		2r25 (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 98 0.79   1090 - 1169   1187 - 1191   1195 - 1207
2 20 0.8   1170 - 1186   1192 - 1194

Sequence


           ________________________________________________________________________________1169_____________1186_1191______________ 
 1oxb(B) : *SVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTI 
         :                                                                                                                          
 2r25(B) : TSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTI 
           ________________________________________________________________________________1169_____________1186_1191______________ 

           _____________                                                                                                            
 1oxb(B) : LTEFC********                                                                                                            
         :                                                                                                                          
 2r25(B) : LTEFCAAYQGKKN                                                                                                            
           _____________                                                                                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		13.8
Translation
(A) 		0.1
Closure
(%) 		99.1
Bending Residues
( green ) 		  1169 - 1170
  1186 - 1187
  1191 - 1192
  1194 - 1195
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download