P-Selectin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name P-Selectin
  Conformer 1
(PDB) 		1g1q (D)
  Conformer 2
(PDB) 		1g1s (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 97 1.46   3 - 54   75 - 119
2 20 0.58   55 - 74
3 37 0.62   120 - 156

Sequence


           ___________________________________________________53___________________74_________________________________________118__ 
 1g1q(D) : WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTA 
         :                                                                                                                          
 1g1s(A) : WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTA 
           ___________________________________________________53___________________74_________________________________________118__ 

           ________________________________________                                                                                 
 1g1q(D) : SCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRDDD                                                                                 
         :                                                                                                                          
 1g1s(A) : SCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRD**                                                                                 
           ________________________________________                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		17.8
Translation
(A) 		0.2
Closure
(%) 		89.9
Bending Residues
( green ) 		  53 - 55
  74 - 75
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		48.0
Translation
(A) 		0.1
Closure
(%) 		99.7
Bending Residues
( green ) 		  118 - 120
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download