Rac-Beta Serine/threonine Protein Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Rac-Beta Serine/threonine Protein Kinase
  Conformer 1
(PDB) 		1gzk (A)
  Conformer 2
(PDB) 		1o6l (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 241 1.72   151 - 292   318 - 349   361 - 436
2 20 3.71   293 - 317   350 - 360

Sequence


           ________________________________________________________________________________________________________________________ 
 1gzk(A) : KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVI---------vTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEY 
         :                                                                                                                          
 1o6l(A) : KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEY 
           ________________________________________________________________________________________________________________________ 

           ______________________290_______________________317__________________________346___________360__________________________ 
 1gzk(A) : LHSRDVVYRDIKLENLMLDKDGHIKITDFGL---------------tPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLK 
         :                                                                                                                          
 1o6l(A) : LHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKfCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLK 
           ______________________290_______________________317__________________________346___________360__________________________ 

           ____________________________________________________________________________                                             
 1gzk(A) : KDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDD*********************                                             
         :                                                                                                                          
 1o6l(A) : KDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITqEMFEDFDYIADW                                             
           ____________________________________________________________________________                                             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		36.1
Translation
(A) 		0.1
Closure
(%) 		8.6
Bending Residues
( green ) 		  290 - 293
  317 - 318
  346 - 350
  360 - 361
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download