Syntenin 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Syntenin 1
  Conformer 1
(PDB) 		1obz (B)
  Conformer 2
(PDB) 		1w9e (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 81 1.0   112 - 192
2 78 0.53   193 - 270

Sequence


           __________________________________________________________________________________192___________________________________ 
 1obz(B) : GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSA 
         :                                                                                                                          
 1w9e(A) : **MDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSA 
           __________________________________________________________________________________192___________________________________ 

           ______________________________________________                                                                           
 1obz(B) : ARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA*                                                                           
         :                                                                                                                          
 1w9e(A) : ARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF                                                                           
           ______________________________________________                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.9
Translation
(A) 		-0.2
Closure
(%) 		27.8
Bending Residues
( green ) 		  192 - 193
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download