Uridine-Cytidine Kinase 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Uridine-Cytidine Kinase 2
  Conformer 1
(PDB) 		1ufq (C)
  Conformer 2
(PDB) 		1uei (B)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 124 1.49   26 - 34   88 - 105   127 - 223
2 28 0.89   60 - 87
3 21 1.07   106 - 126

Sequence


           ____________32_____________________________________________________87_______________105__________________126____________ 
 1ufq(C) : EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGIL 
         :                                                                                                                          
 1uei(B) : EPFLIGVSGGTASGKSSVCAKIVQLLGQ----yRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGIL 
           ____________32_____________________________________________________87_______________105__________________126____________ 

           _____________________________________________________________________________________________                            
 1ufq(C) : AFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN*                            
         :                                                                                                                          
 1uei(B) : AFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNG                            
           _____________________________________________________________________________________________                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		17.7
Translation
(A) 		-0.6
Closure
(%) 		89.8
Bending Residues
( green ) 		  32 - 60
  87 - 88
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		17.6
Translation
(A) 		0.7
Closure
(%) 		63.8
Bending Residues
( green ) 		  105 - 106
  126 - 128
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download