Uridylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Uridylate Kinase
  Conformer 1
(PDB) 		2bnf (A)
  Conformer 2
(PDB) 		2bnd (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 49 0.46   8 - 11   49 - 49   162 - 165   188 - 203   212 - 238
2 148 0.46   12 - 48   50 - 161   204 - 211
3 21 0.55   166 - 187

Sequence


           ______11___________________________________48___________________________________________________________________________ 
 2bnf(A) : *AKPVYKRILLKLSGEALQGTEGFGIDASILDR-aQEIKELVELGIQVGVVIGGGNLFRGAGLAKAG-nRVVGDH-g-lATV-nGLA-rDALHRAYVNARL-sAIPLN-vCDSYSWAEAI 
         :                                                                                                                          
 2bnd(B) : NAKPVYKRILLKLSGEALQGTE-fGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAI 
           ______11___________________________________48___________________________________________________________________________ 

           ___________________________________161_165___________________187__________201________211______________________________   
 2bnf(A) : SLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTAT-yEQLTYSEVLEKELKV-dLAAFTLARDHKLPIRVFN-nKPGALRRVV-gEKEGTLITE   
         :                                                                                                                          
 2bnd(B) : SLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE   
           ___________________________________161_165___________________187__________201________211______________________________   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.1
Translation
(A) 		0.1
Closure
(%) 		79.8
Bending Residues
( green ) 		  11 - 12
  48 - 50
  161 - 162
  201 - 206
  211 - 212
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		10.5
Translation
(A) 		-0.3
Closure
(%) 		75.1
Bending Residues
( green ) 		  165 - 166
  187 - 188
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download