Tryptophan Synthase Beta Chain 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tryptophan Synthase Beta Chain 1
  Conformer 1
(PDB)
1wdw (L)
  Conformer 2
(PDB)
1v8z (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 44 0.54   3 - 7   11 - 14   188 - 188   265 - 292   297 - 297   300 - 304
2 218 0.3   8 - 10   22 - 30   40 - 42   47 - 84   92 - 95   182 - 187   189 - 192   197 - 264   293 - 296   298 - 299   305 - 381
3 114 0.38   18 - 21   31 - 39   43 - 46   85 - 91   96 - 181   193 - 196

Sequence


           ______7_10__14____20_________________39_42__46____________________________________84_____91__95_________________________ 
 1wdw(L) : MWFGEFGGQYVPETLIEPLKELEKAYKRFKDDEEFNRQLNYYLKTWAGRPTPLYYAKRLTEKIGGAKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGAL 
         :                                                                                                                          
 1v8z(B) : MWFGEFGGQYVPETLIEPLKELEKAYKRFKDDEEFNRQLNYYLKTWAGRPTPLYYAKRLTEKIGGAKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGAL 
           ______7_10__14____20_________________39_42__46____________________________________84_____91__95_________________________ 

           __________________________________________________________181__186___192_196____________________________________________ 
 1wdw(L) : LGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNSGSRTLKDAINEALRDWVATFEYTHYLIGSVVGPHPYPTIVRDFQSVIGREAKAQILEAEGQLPDVIVACVGGGSNAMGIFYPFV 
         :                                                                                                                          
 1v8z(B) : LGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNSGSRTLKDAINEALRDWVATFEYTHYLIGSVVGPHPYPTIVRDFQSVIGREAKAQILEAEGQLPDVIVACVGGGSNAMGIFYPFV 
           __________________________________________________________181__186___192_196____________________________________________ 

           _____________________264_________________________292_________304________________________________________________________ 
 1wdw(L) : NDKKVKLVGVEAGGKGLESGKHSASLNAGQVGVFHGMLSYFLQDEEGQIKPTHSIAPGLDYPGVGPEHAYLKKIQRAEYVTVTDEEALKAFHELSRTEGIIPALESAHAVAYAMKLAKEM 
         :                                                                                                                          
 1v8z(B) : NDKKVKLVGVEAGGKGLESGKHSASLNAGQVGVFHGMLSYFLQDEEGQIKPTHSIAPGLDYPGVGPEHAYLKKIQRAEYVTVTDEEALKAFHELSRTEGIIPALESAHAVAYAMKLAKEM 
           _____________________264_________________________292_________304________________________________________________________ 

           ___________________________                                                                                              
 1wdw(L) : SRDEIIIVNLSGRGDKDLDIVLKVS**                                                                                              
         :                                                                                                                          
 1v8z(B) : SRDEIIIVNLSGRGDKDLDIVLKVSGN                                                                                              
           ___________________________                                                                                              

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 5.2 0.1 34.9   7 - 8   10 - 11   186 - 190   264 - 265   292 - 301   304 - 305 Bending Region Analysis
1 3 10.6 0.1 99.8   14 - 18 Bending Region Analysis
3 2 5.3 0.0 51.6   20 - 31   39 - 40   42 - 43   46 - 48   84 - 85   91 - 92   95 - 96   181 - 182   192 - 193   196 - 197 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download