Ras-Related Protein Rab-27b

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ras-Related Protein Rab-27b
  Conformer 1
(PDB) 		2f7s (A)
  Conformer 2
(PDB) 		2f7s (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 104 0.44   8 - 8   12 - 30   94 - 116   121 - 127   129 - 176   182 - 187
2 62 0.71   9 - 11   37 - 93   117 - 120   128 - 128   177 - 181

Sequence


           ___8_11________________29_______________________________________________________93____________________116________127____ 
 2f7s(A) : DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAgKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLI 
         :                                                                                                                          
 2f7s(B) : *YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNA-kAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLI 
           ___8_11________________29_______________________________________________________93____________________116________127____ 

           __________________________________________176__181_________                                                              
 2f7s(A) : GNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVE                                                              
         :                                                                                                                          
 2f7s(B) : GNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCV*                                                              
           __________________________________________176__181_________                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.2
Translation
(A) 		-0.2
Closure
(%) 		90.3
Bending Residues
( green ) 		  8 - 9
  11 - 12
  29 - 37
  93 - 94
  116 - 124
  127 - 129
  176 - 177
  181 - 182
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download