Striated-Muscle Alpha Tropomyosin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Striated-Muscle Alpha Tropomyosin
  Conformer 1
(PDB) 		2b9c (B)
  Conformer 2
(PDB) 		2b9c (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 65 1.65   1122 - 1186
2 21 1.55   1101 - 1121
3 31 0.82   1196 - 1226

Sequence


           _________________________1121_____________________________________________________________1186__________________________ 
 2b9c(B) : QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEDKVE 
         :                                                                                                                          
 2b9c(A) : *****ELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEDKVE 
           __________________________121______________________________________________________________186__________________________ 

           ______________________                                                                                                   
 2b9c(B) : ELLSKNYHLENEVARLKKLVGE                                                                                                   
         :                                                                                                                          
 2b9c(A) : ELLSKNYHLENEVARLKKLVG*                                                                                                   
           ______________________                                                                                                   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.7
Translation
(A) 		-0.8
Closure
(%) 		80.5
Bending Residues
( green ) 		  1121 - 1122
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		19.6
Translation
(A) 		3.5
Closure
(%) 		84.3
Bending Residues
( green ) 		  1186 - 1196
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download