Prgx

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Prgx
  Conformer 1
(PDB) 		2axz (A)
  Conformer 2
(PDB) 		2axu (G)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 90 0.63   79 - 168
2 59 0.35   8 - 68
3 93 0.55   169 - 263
4 20 0.4   264 - 283

Sequence


           ___________________________________________________________63___________________________________________________________ 
 2axz(A) : FKIGSVLKQIRQELNYHQIDLYSGIsKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGnTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHY 
         :                                                                                                                          
 2axu(G) : FKIGSVLKQIRQELNYHQIDLYSGIsKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGn--sVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHY 
           ___________________________________________________________63___________________________________________________________ 

           __________________________________________168___________________________________________________________________________ 
 2axz(A) : NIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPyPIVDSFGKDYDLTIQTVLKNALTISInRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQF 
         :                                                                                                                          
 2axu(G) : NIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPyPIVDSFGKDYDLTIQTVLKNALTISInRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQF 
           __________________________________________168___________________________________________________________________________ 

           _____________261_____________________________________________                                                            
 2axz(A) : LTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVT-yYENYVAIE                                                            
         :                                                                                                                          
 2axu(G) : LTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIE                                                            
           _____________261_____________________________________________                                                            

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 8.8 0.1 19.9   63 - 80 Bending Region Analysis
1 3 9.6 -0.1 99.9   168 - 173 Bending Region Analysis
4 3 10.2 0.4 92.4   261 - 264 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 4 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 4

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download