Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		4bdo (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 127 0.47   7 - 101   107 - 110   213 - 233   237 - 250
2 110 0.47   102 - 106   111 - 212   234 - 236

Sequence


           _______________________________________________________________________________________________101__106_110_____________ 
 2f36(A) : *TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
         :                                                                                                                          
 4bdo(A) : RSLIVTTILEEPYVLFKK----lYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQD---qWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDSA 
           _______________________________________________________________________________________________529__534_538_____________ 

           ______________________________________________________________________________________212__________________233__________ 
 2f36(A) : DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKL 
         :                                                                                                                          
 4bdo(A) : DDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKIGIAILQLQEEGKL 
           ______________________________________________________________________________________760__________________781__________ 

           _______________                                                                                                          
 2f36(A) : HMMKEKWWRGNGCPS                                                                                                          
         :                                                                                                                          
 4bdo(A) : HMMKEKWWR******                                                                                                          
           _______________                                                                                                          

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.4
Translation
(A) 		0.1
Closure
(%) 		92.3
Bending Residues
( green ) 		  101 - 102
  106 - 107
  110 - 111
  212 - 214
  233 - 234
  236 - 237
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download