Ionotropic Glutamate Receptor 5

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ionotropic Glutamate Receptor 5
  Conformer 1
(PDB) 		2f35 (A)
  Conformer 2
(PDB) 		1yae (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 143 0.74   7 - 108   212 - 252
2 100 0.96   109 - 211

Sequence


           _______________________________________________________________________________________________________________108______ 
 2f35(A) : ********RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILY 
         :                                                                                                                          
 1yae(C) : NITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILY 
           _______________________________________________________________________________________________________________536______ 

           ______________________________________________________________________________________________211_______________________ 
 2f35(A) : RKGTPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAI 
         :                                                                                                                          
 1yae(C) : RK--P-dSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAI 
           ______________________________________________________________________________________________759_______________________ 

           ____________________                                                                                                     
 2f35(A) : LQLQEEGKLHMMKEKWWRGN                                                                                                     
         :                                                                                                                          
 1yae(C) : LQLQEEGKLHMMKEKWWRGN                                                                                                     
           ____________________                                                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		20.3
Translation
(A) 		0.4
Closure
(%) 		89.7
Bending Residues
( green ) 		  108 - 109
  211 - 212
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download