Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1ftm (A)
  Conformer 2
(PDB) 		1ftk (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 35 0.25   109 - 114   192 - 218   258 - 259
2 139 0.51   6 - 108   219 - 257
3 72 0.5   115 - 191

Sequence


           ______________________________________________________________________________________________________108___114_________ 
 1ftm(A) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 1ftk(A) : KTVVVTTILESPYVMMKK---mLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIK-----eS 
           ______________________________________________________________________________________________________120___126_________ 

           _________________________________________________________________191_______________________217__________________________ 
 1ftm(A) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
         :                                                                                                                          
 1ftk(A) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           _________________________________________________________________207_______________________233__________________________ 

           ___________257____                                                                                                       
 1ftm(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 1ftk(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
           ___________273____                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.7
Translation
(A) 		-0.1
Closure
(%) 		99.9
Bending Residues
( green ) 		  108 - 110
  217 - 219
  257 - 259
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		5.3
Translation
(A) 		-0.1
Closure
(%) 		13.8
Bending Residues
( green ) 		  114 - 115
  191 - 192
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download