Ionotropic Glutamate Receptor 5

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ionotropic Glutamate Receptor 5
  Conformer 1
(PDB) 		2f35 (A)
  Conformer 2
(PDB) 		1yae (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 141 0.73   7 - 108   214 - 252
2 102 0.62   109 - 213

Sequence


           _________________________________________________________________________________________________________________108____ 
 2f35(A) : **********RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISI 
         :                                                                                                                          
 1yae(A) : PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI 
           _________________________________________________________________________________________________________________536____ 

           ________________________________________________________________________________________________211_____________________ 
 2f35(A) : LYRKGTPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITI 
         :                                                                                                                          
 1yae(A) : LYRK---iDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI 
           ________________________________________________________________________________________________759_____________________ 

           ________________________                                                                                                 
 2f35(A) : AILQLQEEGKLHMMKEKWWRGN**                                                                                                 
         :                                                                                                                          
 1yae(A) : AILQLQEEGKLHMMKEKWWRGNGC                                                                                                 
           ________________________                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		19.7
Translation
(A) 		0.5
Closure
(%) 		92.6
Bending Residues
( green ) 		  108 - 109
  211 - 214
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download