Mitogen-Activated Protein Kinase 14

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mitogen-Activated Protein Kinase 14
  Conformer 1
(PDB) 		3py3 (A)
  Conformer 2
(PDB) 		1cm8 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 246 2.02   58 - 89   91 - 95   105 - 241   263 - 347
2 54 0.99   8 - 57   90 - 90   96 - 104
3 21 2.22   242 - 262

Sequence


           _______________________________________________________54_________________________________89____95______104_____________ 
 3py3(A) : GSHMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIV 
         :                                                                                                                          
 1cm8(A) : *******RSGFYRQEVTKTAWEVRAVYRDLQPV------aVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM 
           _______________________________________________________57_________________________________92____98______107_____________ 

           _______________________________________________________________________________________________________________________2 
 3py3(A) : KCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMgvATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV 
         :                                                                                                                          
 1cm8(A) : KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMgvVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVT 
           _______________________________________________________________________________________________________________________2 

           41__________________262____________________________________________________________________________________________      
 3py3(A) : GTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD      
         :                                                                                                                          
 1cm8(A) : GTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHq------VQKYD---DSrTL--DEWKRVTYKEVLSFKP****      
           44__________________265____________________________________________________________________________________________      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.9
Translation
(A) 		-0.4
Closure
(%) 		99.9
Bending Residues
( green ) 		  54 - 58
  89 - 91
  95 - 96
  104 - 105
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		32.1
Translation
(A) 		-1.2
Closure
(%) 		99.4
Bending Residues
( green ) 		  241 - 242
  262 - 263
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download