Nitrate/nitrite Response Regulator Protein Narl

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Nitrate/nitrite Response Regulator Protein Narl
  Conformer 1
(PDB) 		1a04 (B)
  Conformer 2
(PDB) 		1zg5 (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 29 0.43   156 - 162   190 - 213
2 26 0.47   163 - 189

Sequence


           ________________________________________________________________________________________________________________________ 
 1a04(B) : EPATILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAA 
         :                                                                                                                          
 1zg5(B) : ************************************************************************************************************************ 
           ________________________________________________________________________________________________________________________ 

           ____________________________162________________________189___________________________                                    
 1a04(B) : AGEMVLSEALTPVLAASLeRDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF                                    
         :                                                                                                                          
 1zg5(B) : *******************RDVNQLTPRERDILKLIAQGLPNK-iARRLDITESTVKVHVKH-lKK-kLKSRVEAAVWVHQERIF                                    
           ____________________________162________________________189___________________________                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.2
Translation
(A) 		0.4
Closure
(%) 		98.3
Bending Residues
( green ) 		  162 - 163
  189 - 190
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download