Pantothenate Synthetase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Pantothenate Synthetase
  Conformer 1
(PDB) 		3ag5 (B)
  Conformer 2
(PDB) 		3ag6 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 168 1.01   3 - 115   118 - 176
2 107 1.29   116 - 117   177 - 281

Sequence


           _______________________________________________________________________________________________________________114______ 
 3ag5(B) : MTKLITTVKEMQHIVKAAKRSGTTIGFIPTMGALHDGHLTMVRESVSTNDITIVSVFVNPLQF----dFDAYPRQIDKDLELVSEVGADIVFHPAVEDMYPGELGIDVKVGPLADVLEGA 
         :                                                                                                                          
 3ag6(B) : MTKLITTVKEMQHIVKAAKRSGTTIGFIPTMGALHDGHLTMVRESVSTNDITIVSVFVNPLQFGPNEDFDAYPRQIDKDLELVSEVGADIVFHPAVEDMYPGELGIDVKVGPLADVLEGA 
           _______________________________________________________________________________________________________________114______ 

           _____________________________________________________176________________________________________________________________ 
 3ag5(B) : KRPGHFDGVVTVVNKLFNIVMPDYAYFGKKDAQQLAIVEQMVKDFNHAVEIIGIDIVREADGLAKSSRNVYLTEQERQEAVHLSKSLLLAQALYQDGERQSKVIIDRVTEYLESHISERI 
         :                                                                                                                          
 3ag6(B) : KRPGHFDGVVTVVNKLFNIVMPDYAYFGKKDAQQLAIVEQMVKDFNHAVEIIGIDIVREADGLAKSSRNVYLTEQERQEAVHLSKSLLLAQALYQDGERQSKVIIDRVTEYLESHISERI 
           _____________________________________________________176________________________________________________________________ 

           ___________________________________________                                                                              
 3ag5(B) : EEVAVYSYPQLVEQHEITGRIFISLAVKFSKARLIDNIIIGAE                                                                              
         :                                                                                                                          
 3ag6(B) : EEVAVYSYPQLVEQHEITGRIFISLAVKFSKARLIDNIIIGAE                                                                              
           ___________________________________________                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		35.6
Translation
(A) 		0.2
Closure
(%) 		91.9
Bending Residues
( green ) 		  114 - 124
  176 - 177
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download