Transcription Antitermination Protein Nusg

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcription Antitermination Protein Nusg
  Conformer 1
(PDB) 		1npr (A)
  Conformer 2
(PDB) 		1npp (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 103 2.0   9 - 50   131 - 131   133 - 192
2 81 0.43   51 - 130   132 - 132
3 54 1.07   193 - 246

Sequence


           ____________________________________________50__________________________________________________________________________ 
 1npr(A) : **QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKT 
         :                                                                                                                          
 1npp(A) : QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKT 
           ____________________________________________50__________________________________________________________________________ 

           ___130______________________________________________________187_________________________________________________________ 
 1npr(A) : EAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQ 
         :                                                                                                                          
 1npp(A) : EAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQ 
           ___130______________________________________________________187_________________________________________________________ 

           ____                                                                                                                     
 1npr(A) : VEKI                                                                                                                     
         :                                                                                                                          
 1npp(A) : VEKI                                                                                                                     
           ____                                                                                                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		47.7
Translation
(A) 		-1.4
Closure
(%) 		7.4
Bending Residues
( green ) 		  50 - 51
  130 - 133
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		67.6
Translation
(A) 		6.2
Closure
(%) 		42.9
Bending Residues
( green ) 		  187 - 195
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download