Transcriptional Repressor Tram

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Repressor Tram
  Conformer 1
(PDB) 		1rfy (A)
  Conformer 2
(PDB) 		1rfy (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 22 0.22   36 - 48   74 - 82
2 30 0.37   20 - 35   83 - 96
3 25 0.26   49 - 73

Sequence


           ________________________35___________48_______________________73_______82_________________                               
 1rfy(A) : KKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLISILGFIPK*                               
         :                                                                                                                          
 1rfy(B) : **VELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLISILGFIPKV                               
           ________________________35___________48_______________________73_______82_________________                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.0
Translation
(A) 		0.2
Closure
(%) 		88.5
Bending Residues
( green ) 		  35 - 36
  82 - 83
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		9.1
Translation
(A) 		-0.1
Closure
(%) 		23.2
Bending Residues
( green ) 		  48 - 49
  73 - 74
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download