Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		4bdl (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 137 0.7   10 - 111   212 - 246
2 100 0.39   112 - 211

Sequence


           __________________________________________________________________________________________________________111___________ 
 2f36(A) : *TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDS 
         :                                                                                                                          
 4bdl(A) : RSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDS 
           __________________________________________________________________________________________________________539___________ 

           ______________________________________________________________________________________211_______________________________ 
 2f36(A) : ADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGK 
         :                                                                                                                          
 4bdl(A) : ADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGK 
           ______________________________________________________________________________________759_______________________________ 

           ________________                                                                                                         
 2f36(A) : LHMMKEKWWRGNGCPS                                                                                                         
         :                                                                                                                          
 4bdl(A) : LHMMKEKWW*******                                                                                                         
           ________________                                                                                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.0
Translation
(A) 		0.0
Closure
(%) 		84.8
Bending Residues
( green ) 		  111 - 112
  211 - 214
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download