Ionotropic Glutamate Receptor 5

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ionotropic Glutamate Receptor 5
  Conformer 1
(PDB) 		2f35 (A)
  Conformer 2
(PDB) 		2xxt (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 137 0.75   7 - 107   214 - 249
2 106 0.55   108 - 213

Sequence


           ______________________________________________________________________________________________________107_______________ 
 2f35(A) : RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDS 
         :                                                                                                                          
 2xxt(B) : *SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDS 
           ______________________________________________________________________________________________________535_______________ 

           _____________________________________________________________________________________210________________________________ 
 2f35(A) : ADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGK 
         :                                                                                                                          
 2xxt(B) : ADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGK 
           _____________________________________________________________________________________758________________________________ 

           ____________                                                                                                             
 2f35(A) : LHMMKEKWWRGN                                                                                                             
         :                                                                                                                          
 2xxt(B) : LHMMKEKWW***                                                                                                             
           ____________                                                                                                             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		23.6
Translation
(A) 		0.9
Closure
(%) 		99.4
Bending Residues
( green ) 		  107 - 109
  210 - 214
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download