Peptidyl-Prolyl Cis-Trans Isomerase Slyd

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase Slyd
  Conformer 1
(PDB) 		4odm (C)
  Conformer 2
(PDB) 		4odo (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 105 0.89   3 - 66   93 - 101   117 - 148
2 41 0.46   67 - 92   102 - 116

Sequence


           ________________________________________________________________66________________________92_____________________116____ 
 4odm(C) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
         :                                                                                                                          
 4odo(A) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
           ________________________________________________________________66________________________92_____________________116____ 

           _________________________________                                                                                        
 4odm(C) : LAGKDLDFQVEVVKVREATPEELLHGHAHLVPK                                                                                        
         :                                                                                                                          
 4odo(A) : LAGKDLDFQVEVVKVREATPEELLHGHAHP***                                                                                        
           _________________________________                                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.2
Translation
(A) 		-0.3
Closure
(%) 		86.9
Bending Residues
( green ) 		  66 - 67
  92 - 103
  116 - 117
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download