Peptidyl-Prolyl Cis-Trans Isomerase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase
  Conformer 1
(PDB) 		1pin (A)
  Conformer 2
(PDB) 		1nmv (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 111 1.5   51 - 161
2 32 1.31   8 - 39

Sequence


           ___________________________________37___________________________________________________________________________________ 
 1pin(A) : *****KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSG-----gKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG 
         :                                                                                                                          
 1nmv(A) : MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG 
           ___________________________________37___________________________________________________________________________________ 

           ___________________________________________                                                                              
 1pin(A) : DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE                                                                              
         :                                                                                                                          
 1nmv(A) : DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE                                                                              
           ___________________________________________                                                                              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		115.7
Translation
(A) 		-15.2
Closure
(%) 		75.6
Bending Residues
( green ) 		  37 - 54
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download