Probable 8-Oxo-Dgtp Diphosphatase Nudt15

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Probable 8-Oxo-Dgtp Diphosphatase Nudt15
  Conformer 1
(PDB) 		5bon (A)
  Conformer 2
(PDB) 		5lpg (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 122 0.45   18 - 79   98 - 157
2 20 0.36   16 - 17   80 - 97

Sequence


           ______16_____________________________________________________________79________________97_______________________________ 
 5bon(A) : GRRPGVGVGVVVTSCKHPRCVLLGKRKGSVGAGSFQLPGGHLEFGETWEECAQRETWEEAALHLKNVHFASVVNSFIEKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEEL 
         :                                                                                                                          
 5lpg(A) : GRRPGVGVGVVVTSCKHPRCVLLGKRKGSVGAGSFQLPGGHLEFGETWEECAQRETWEEAALHLKNVHFASVVNSFIEKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEEL 
           ______16_____________________________________________________________79________________97_______________________________ 

           ____________________________________                                                                                     
 5bon(A) : PPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL                                                                                     
         :                                                                                                                          
 5lpg(A) : PPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL                                                                                     
           ____________________________________                                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.3
Translation
(A) 		0.0
Closure
(%) 		4.8
Bending Residues
( green ) 		  16 - 18
  79 - 80
  97 - 99
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download