Sortase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Sortase
  Conformer 1
(PDB) 		4o8l (A)
  Conformer 2
(PDB) 		4o8l (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 104 0.5   84 - 187
2 58 1.19   188 - 245

Sequence


           _____________________________________________________________________________________________________________186________ 
 4o8l(A) : *****HMVLTSQWDAQKLPVIGGIAIPELEMNLPIFKGLDNVNLFYGAGTMKREQVMGEGNYSLASHHIFGVDNANKMLFSPLDNAKNGMKIYLTDKNKVYAYEIREVKRVTPDRVDEVD 
         :                                                                                                                          
 4o8l(C) : VPRGSHMVLTSQWDAQKLPVIGGIAIPELEMNLPIFKGLDNVNLFYGAGTMKREQVMGEGNYSLASHHIFGVDNANKMLFSPLDNAKNGMKIYLTDKNKVYAYEIREVKRVTPDRVDEVD 
           _____________________________________________________________________________________________________________186________ 

           _____________________________________________________                                                                    
 4o8l(A) : DRDGVNEITLVTCEDLAATERIIVKGDLKETKDYSQTSDEILTAFNQPYKQFY                                                                    
         :                                                                                                                          
 4o8l(C) : DRDGVNEITLVTCEDLAATERIIVKGDLKETKDYSQTSDEILTAFNQPYKQFY                                                                    
           _____________________________________________________                                                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		28.3
Translation
(A) 		-0.1
Closure
(%) 		13.5
Bending Residues
( green ) 		  186 - 188
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download