Sthk_cnbd_cgmp

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Sthk_cnbd_cgmp
  Conformer 1
(PDB) 		4d7s (A)
  Conformer 2
(PDB) 		4d7t (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 144 0.71   276 - 420
2 41 1.02   228 - 268

Sequence


           _______________________________________267______________________________________________________________________________ 
 4d7s(A) : DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGS 
         :                                                                                                                          
 4d7t(A) : DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGS 
           _______________________________________267______________________________________________________________________________ 

           ______________________________________________________________________________                                           
 4d7s(A) : VEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEIAAQIQELAVRRKEEL*                                           
         :                                                                                                                          
 4d7t(A) : VEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPE-aAQIQELAVRRKEELE                                           
           ______________________________________________________________________________                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.2
Translation
(A) 		-0.1
Closure
(%) 		84.6
Bending Residues
( green ) 		  267 - 279
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download