Succinate Dehydrogenase Ip Subunit

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Succinate Dehydrogenase Ip Subunit
  Conformer 1
(PDB) 		2fbw (B)
  Conformer 2
(PDB) 		2fbw (C)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 27 8.15   16 - 22   97 - 116
2 25 7.47   33 - 57

Sequence


           ________________________________22_________________________________57___________________________________________________ 
 2fbw(B) : *******************TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVV 
         :                                                                                                                          
 2fbw(C) : ATTAKEEMARFWEKNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSVAALLLPEQFPHYVAVVKSLSLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFKLSQVEQ 
           ________________________________35_________________________________70___________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 2fbw(B) : KDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKG 
         :                                                                                                                          
 2fbw(C) : SGVVVLILTLLSSAGIAAIS**************************************************************************************************** 
           ________________________________________________________________________________________________________________________ 

           __________________                                                                                                       
 2fbw(B) : LNPGKAIAEIKKMMATYK                                                                                                       
         :                                                                                                                          
 2fbw(C) : ******************                                                                                                       
           __________________                                                                                                       

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		121.4
Translation
(A) 		24.7
Closure
(%) 		99.7
Bending Residues
( green ) 		  22 - 33
  57 - 98
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download