Tp7 Fab

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tp7 Fab
  Conformer 1
(PDB) 		1dqd (L)
  Conformer 2
(PDB) 		1axt (L)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 104 0.86   3 - 106
2 102 0.78   107 - 208

Sequence


           _____________________________________________________________________________________________________________106________ 
 1dqd(L) : DIVLSQSPAIMSASPGEKVTITCSASSSV------SYMHWFQQKPGTSPKLCIYTTSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSTYPPTFGSGTKLEIKRADAAPTV 
         :                                                                                                                          
 1axt(L) : ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSYGNTFLNWYLQKSGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLEIKRADAAPTV 
           _____________________________________________________________________________________________________________107________ 

           ____________________________________________________________________________________________________                     
 1dqd(L) : SIFPPSSEQLTSGGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECA                     
         :                                                                                                                          
 1axt(L) : SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR****                     
           ____________________________________________________________________________________________________                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.5
Translation
(A) 		0.5
Closure
(%) 		99.9
Bending Residues
( green ) 		  106 - 107
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download