Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		2xxv (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 124 0.73   16 - 34   106 - 210
2 109 0.45   12 - 15   35 - 105   211 - 244

Sequence


           _________15_________________34_____________________________________________________________________105__________________ 
 2f36(A) : TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
         :                                                                                                                          
 2xxv(A) : SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
           ________442________________461_____________________________________________________________________533__________________ 

           ____________________________________________________________________________________210_________________________________ 
 2f36(A) : DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKL 
         :                                                                                                                          
 2xxv(A) : DDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPKGSPYRDKITIAILQLQEEGKL 
           ____________________________________________________________________________________758_________________________________ 

           _______________                                                                                                          
 2f36(A) : HMMKEKWWRGNGCPS                                                                                                          
         :                                                                                                                          
 2xxv(A) : HMMKEKWW*******                                                                                                          
           _______________                                                                                                          

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.1
Translation
(A) 		-0.2
Closure
(%) 		88.0
Bending Residues
( green ) 		  15 - 16
  34 - 35
  105 - 106
  210 - 215
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download