Hemagglutinin (Bromelain Digested)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hemagglutinin (Bromelain Digested)
  Conformer 1
(PDB) 		1hgf (B)
  Conformer 2
(PDB) 		1htm (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 43 5.36   70 - 112
2 30 3.4   113 - 142

Sequence


           _____________________________________________________________________________________________________________112________ 
 1hgf(B) : GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFE 
         :                                                                                                                          
 1htm(B) : ***************************************STQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFE 
           _____________________________________________________________________________________________________________112________ 

           _______________________________________________________                                                                  
 1hgf(B) : KTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKG                                                                  
         :                                                                                                                          
 1htm(B) : KTRRQLRENAEEMGNGCFKIYHKCDNACIESIR**********************                                                                  
           _______________________________________________________                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		177.2
Translation
(A) 		6.5
Closure
(%) 		95.3
Bending Residues
( green ) 		  112 - 113
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download